SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ch1a_ (1ch1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978220Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (261 PDB entries)
    Uniprot P02185
  8. 1978396Domain d1ch1a_: 1ch1 A: [15094]
    complexed with hem, so4

Details for d1ch1a_

PDB Entry: 1ch1 (more details), 1.9 Å

PDB Description: Recombinant sperm whale myoglobin L89G mutatnt (MET)
PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1ch1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ch1a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkpgaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1ch1a_:

Click to download the PDB-style file with coordinates for d1ch1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ch1a_: