Lineage for d2qnhp1 (2qnh p:2-89)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1971258Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1971414Domain d2qnhp1: 2qnh p:2-89 [150939]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhn1, d2qnho1, d2qnhr1, d2qnhs1, d2qnhu1, d2qnhv1

Details for d2qnhp1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (p:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2qnhp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhp1 i.1.1.1 (p:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2qnhp1:

Click to download the PDB-style file with coordinates for d2qnhp1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhp1: