![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein 70S ribosome functional complex [58121] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
![]() | Domain d2qnhp1: 2qnh p:2-89 [150939] Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhn1, d2qnho1, d2qnhr1, d2qnhs1, d2qnhu1, d2qnhv1 |
PDB Entry: 2qnh (more details), 3.83 Å
SCOPe Domain Sequences for d2qnhp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnhp1 i.1.1.1 (p:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d2qnhp1: