Lineage for d2qnhg1 (2qnh g:1-101)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416810Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1416811Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1416812Protein Ribosomal protein S6 [54997] (4 species)
  7. 1416842Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1416887Domain d2qnhg1: 2qnh g:1-101 [150930]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d1fjgf_

Details for d2qnhg1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (g:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qnhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhg1 d.58.14.1 (g:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2qnhg1:

Click to download the PDB-style file with coordinates for d2qnhg1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhg1: