SCOPe 2.02: Domain d1mlua_: 1mlu A:

Lineage for d1mlua_ (1mlu A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (229 PDB entries)
   Uniprot P02185

8. Domain d1mlua_: 1mlu A: [15093]
   complexed with cmo, hem, so4; mutant

Details for d1mlua_

PDB Entry: 1mlu, 1.9 Å

PDB Description: nitric oxide recombination to double mutants of myoglobin: the role of ligand diffusion in a fluctuating heme pocket

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1mlua_:

Sequence; same for both SEQRES and ATOM records:

>d1mlua_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkggvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1mlua_:

• d1mlua_ first appeared (with stable ids) in SCOP 1.55, called d1mlu__
  
• d1mlua_ appears in SCOPe 2.01
  
• d1mlua_ appears in SCOPe 2.03
  
• d1mlua_ appears in the current release, SCOPe 2.08