| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.5: Recombination endonuclease VII, N-terminal domain [68915] (1 protein) |
| Protein Recombination endonuclease VII, N-terminal domain [68916] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [68917] (5 PDB entries) |
| Domain d2qnfb2: 2qnf B:1-103 [150926] Other proteins in same PDB: d2qnfa1, d2qnfb1 automated match to d1en7a2 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 2qnf (more details), 3 Å
SCOPe Domain Sequences for d2qnfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnfb2 d.4.1.5 (B:1-103) Recombination endonuclease VII, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}
mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdnelngpkagkvrgllcnl
cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnn
Timeline for d2qnfb2: