| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) ![]() automatically mapped to Pfam PF09124 |
| Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein) |
| Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries) |
| Domain d2qnfb1: 2qnf B:104-157 [150925] Other proteins in same PDB: d2qnfa2, d2qnfb2 automated match to d1e7la1 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 2qnf (more details), 3 Å
SCOPe Domain Sequences for d2qnfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnfb1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk
Timeline for d2qnfb1: