Lineage for d2qnfb1 (2qnf B:104-157)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012958Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2013047Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) (S)
    automatically mapped to Pfam PF09124
  5. 2013048Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)
  6. 2013049Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)
  7. 2013050Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries)
  8. 2013058Domain d2qnfb1: 2qnf B:104-157 [150925]
    Other proteins in same PDB: d2qnfa2, d2qnfb2
    automated match to d1e7la1
    protein/DNA complex; complexed with zn; mutant

Details for d2qnfb1

PDB Entry: 2qnf (more details), 3 Å

PDB Description: Crystal structure of T4 Endonuclease VII H43N mutant in complex with heteroduplex DNA containing base mismatches
PDB Compounds: (B:) recombination endonuclease vii

SCOPe Domain Sequences for d2qnfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnfb1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOPe Domain Coordinates for d2qnfb1:

Click to download the PDB-style file with coordinates for d2qnfb1.
(The format of our PDB-style files is described here.)

Timeline for d2qnfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qnfb2