| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) ![]() automatically mapped to Pfam PF09124 |
| Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein) |
| Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries) |
| Domain d2qncb1: 2qnc B:104-157 [150921] Other proteins in same PDB: d2qnca2, d2qncb2 automated match to d1e7la1 protein/DNA complex; complexed with edo, mg, zn; mutant |
PDB Entry: 2qnc (more details), 3.1 Å
SCOPe Domain Sequences for d2qncb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qncb1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk
Timeline for d2qncb1: