SCOPe 2.06: Domain d2qnca1: 2qnc A:104-157

Lineage for d2qnca1 (2qnc A:104-157)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family)
   automatically mapped to Pfam PF09124

5. Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)

6. Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries)

8. Domain d2qnca1: 2qnc A:104-157 [150919]
   Other proteins in same PDB: d2qnca2, d2qncb2
   automated match to d1e7la1
   protein/DNA complex; complexed with edo, mg, zn; mutant

Details for d2qnca1

PDB Entry: 2qnc, 3.1 Å

PDB Description: crystal structure of t4 endonuclease vii n62d mutant in complex with a dna holliday junction

PDB Compounds: (A:) recombination endonuclease vii

SCOPe Domain Sequences for d2qnca1:

Sequence; same for both SEQRES and ATOM records:

>d2qnca1 a.140.4.1 (A:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

Timeline for d2qnca1:

• d2qnca1 first appeared in SCOP 1.75
  
• d2qnca1 appears in SCOPe 2.05
  
• d2qnca1 appears in SCOPe 2.07
  
• d2qnca1 appears in the current release, SCOPe 2.08