Lineage for d2qnca1 (2qnc A:104-157)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751447Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1751536Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) (S)
    automatically mapped to Pfam PF09124
  5. 1751537Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein)
  6. 1751538Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species)
  7. 1751539Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries)
  8. 1751548Domain d2qnca1: 2qnc A:104-157 [150919]
    Other proteins in same PDB: d2qnca2, d2qncb2
    automated match to d1e7la1
    protein/DNA complex; complexed with edo, mg, zn; mutant

Details for d2qnca1

PDB Entry: 2qnc (more details), 3.1 Å

PDB Description: crystal structure of t4 endonuclease vii n62d mutant in complex with a dna holliday junction
PDB Compounds: (A:) recombination endonuclease vii

SCOPe Domain Sequences for d2qnca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnca1 a.140.4.1 (A:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]}
ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk

SCOPe Domain Coordinates for d2qnca1:

Click to download the PDB-style file with coordinates for d2qnca1.
(The format of our PDB-style files is described here.)

Timeline for d2qnca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qnca2