Lineage for d2qn6b1 (2qn6 B:176-264)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 864117Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 864118Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 864119Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 864122Species Sulfolobus solfataricus [TaxId:2287] [143409] (3 PDB entries)
    Uniprot Q97Z79 176-264
  8. 864123Domain d2qn6b1: 2qn6 B:176-264 [150914]
    Other proteins in same PDB: d2qn6a1, d2qn6a2, d2qn6a3
    automatically matched to d2ahob3
    complexed with gdp, mg

Details for d2qn6b1

PDB Entry: 2qn6 (more details), 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOP Domain Sequences for d2qn6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qn6b1 d.58.51.1 (B:176-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvv

SCOP Domain Coordinates for d2qn6b1:

Click to download the PDB-style file with coordinates for d2qn6b1.
(The format of our PDB-style files is described here.)

Timeline for d2qn6b1: