SCOPe 2.04: Domain d2qn5t_: 2qn5 T:

Lineage for d2qn5t_ (2qn5 T:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (393 PDB entries)
   Uniprot P00760

8. Domain d2qn5t_: 2qn5 T: [150910]
   Other proteins in same PDB: d2qn5b1, d2qn5b2
   automated match to d4i8ha_

Details for d2qn5t_

PDB Entry: 2qn5, 3 Å

PDB Description: Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin

PDB Compounds: (T:) cationic trypsin

SCOPe Domain Sequences for d2qn5t_:

Sequence; same for both SEQRES and ATOM records:

>d2qn5t_ b.47.1.2 (T:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2qn5t_:

• d2qn5t_ first appeared in SCOP 1.75, called d2qn5t1
  
• d2qn5t_ was called d2qn5t1 in SCOPe 2.03
  
• d2qn5t_ appears in SCOPe 2.05
  
• d2qn5t_ appears in the current release, SCOPe 2.08