Lineage for d2qn3a1 (2qn3 A:12-835)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845255Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 845256Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families) (S)
  5. 845308Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 845309Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 845338Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (103 PDB entries)
    Uniprot P00489
    Uniprot P00489
    Uniprot P00489 ! Uniprot P00489
  8. 845352Domain d2qn3a1: 2qn3 A:12-835 [150909]
    automatically matched to d1e1ya_
    complexed with f55

Details for d2qn3a1

PDB Entry: 2qn3 (more details), 1.96 Å

PDB Description: Glycogen Phosphorylase in complex with N-4-chlorobenzoyl-N-beta-D-glucopyranosyl urea
PDB Compounds: (A:) Glycogen phosphorylase, muscle form

SCOP Domain Sequences for d2qn3a1:

Sequence, based on SEQRES records: (download)

>d2qn3a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrf
ksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvkt
caytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslv
eegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrw
lvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayler
eykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaap
gyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagt
easgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqey
ydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsaly
knprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlp

Sequence, based on observed residues (ATOM records): (download)

>d2qn3a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
fnlnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkss
tnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
niatsgkfssdrtiaqyareiwgvepsrqrlp

SCOP Domain Coordinates for d2qn3a1:

Click to download the PDB-style file with coordinates for d2qn3a1.
(The format of our PDB-style files is described here.)

Timeline for d2qn3a1: