Lineage for d2qmza1 (2qmz A:1-230)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826033Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 826097Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 826098Species Human (Homo sapiens) [TaxId:9606] [52241] (13 PDB entries)
  8. 826113Domain d2qmza1: 2qmz A:1-230 [150905]
    automatically matched to d1qr2a_
    complexed with fad, ldp, zn

Details for d2qmza1

PDB Entry: 2qmz (more details), 2.1 Å

PDB Description: quinone reductase 2 in complex with dopamine
PDB Compounds: (A:) Ribosyldihydronicotinamide dehydrogenase

SCOP Domain Sequences for d2qmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmza1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOP Domain Coordinates for d2qmza1:

Click to download the PDB-style file with coordinates for d2qmza1.
(The format of our PDB-style files is described here.)

Timeline for d2qmza1: