Lineage for d2qmwb1 (2qmw B:1-184)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879860Protein Prephenate dehydratase [159808] (1 species)
  7. 1879861Species Staphylococcus aureus [TaxId:1280] [159809] (1 PDB entry)
    Uniprot Q99SX2 1-184
  8. 1879863Domain d2qmwb1: 2qmw B:1-184 [150901]
    Other proteins in same PDB: d2qmwa2, d2qmwb2
    automated match to d2qmwa1
    complexed with act, edo, na, peg

Details for d2qmwb1

PDB Entry: 2qmw (more details), 2.3 Å

PDB Description: The crystal structure of the prephenate dehydratase (PDT) from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (B:) Prephenate dehydratase

SCOPe Domain Sequences for d2qmwb1:

Sequence, based on SEQRES records: (download)

>d2qmwb1 c.94.1.1 (B:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]}
mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt
inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf
dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd
qnat

Sequence, based on observed residues (ATOM records): (download)

>d2qmwb1 c.94.1.1 (B:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]}
mqlyylgpkgtfsylacrqyfsatfqpksnlfevikavadtsigvvpiensiinivadal
aqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqfdydyvdst
iqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfnat

SCOPe Domain Coordinates for d2qmwb1:

Click to download the PDB-style file with coordinates for d2qmwb1.
(The format of our PDB-style files is described here.)

Timeline for d2qmwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qmwb2