Lineage for d2qmwa2 (2qmw A:185-264)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029255Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1029286Family d.58.18.3: Phenylalanine metabolism regulatory domain [55028] (2 proteins)
  6. 1029291Protein Prephenate dehydratase C-terminal domain [160320] (1 species)
  7. 1029292Species Staphylococcus aureus [TaxId:1280] [160321] (1 PDB entry)
    Uniprot Q99SX2 185-264
  8. 1029293Domain d2qmwa2: 2qmw A:185-264 [150900]
    Other proteins in same PDB: d2qmwa1, d2qmwb1
    complexed with act, edo, na, peg

Details for d2qmwa2

PDB Entry: 2qmw (more details), 2.3 Å

PDB Description: The crystal structure of the prephenate dehydratase (PDT) from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (A:) Prephenate dehydratase

SCOPe Domain Sequences for d2qmwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
slmflitpmhdkpgllasvlntfalfninlswiesrplktqlgmyrffvqadsaittdik
kviailetldfkvemigafn

SCOPe Domain Coordinates for d2qmwa2:

Click to download the PDB-style file with coordinates for d2qmwa2.
(The format of our PDB-style files is described here.)

Timeline for d2qmwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qmwa1