Lineage for d2qmwa1 (2qmw A:1-184)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009255Protein Prephenate dehydratase [159808] (1 species)
  7. 1009256Species Staphylococcus aureus [TaxId:1280] [159809] (1 PDB entry)
    Uniprot Q99SX2 1-184
  8. 1009257Domain d2qmwa1: 2qmw A:1-184 [150899]
    Other proteins in same PDB: d2qmwa2, d2qmwb2
    complexed with act, edo, na, peg

Details for d2qmwa1

PDB Entry: 2qmw (more details), 2.3 Å

PDB Description: The crystal structure of the prephenate dehydratase (PDT) from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (A:) Prephenate dehydratase

SCOPe Domain Sequences for d2qmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]}
mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt
inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf
dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd
qnat

SCOPe Domain Coordinates for d2qmwa1:

Click to download the PDB-style file with coordinates for d2qmwa1.
(The format of our PDB-style files is described here.)

Timeline for d2qmwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qmwa2