SCOP 1.75: Domain d2qmwa1: 2qmw A:1-184

Lineage for d2qmwa1 (2qmw A:1-184)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Prephenate dehydratase [159808] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [159809] (1 PDB entry)
   Uniprot Q99SX2 1-184

8. Domain d2qmwa1: 2qmw A:1-184 [150899]
   Other proteins in same PDB: d2qmwa2, d2qmwb2
   complexed with act, edo, na, peg

Details for d2qmwa1

PDB Entry: 2qmw, 2.3 Å

PDB Description: The crystal structure of the prephenate dehydratase (PDT) from Staphylococcus aureus subsp. aureus Mu50

PDB Compounds: (A:) Prephenate dehydratase

SCOP Domain Sequences for d2qmwa1:

Sequence; same for both SEQRES and ATOM records:

>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]}
mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt
inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf
dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd
qnat

Timeline for d2qmwa1:

• d2qmwa1 is new in SCOP 1.75
  
• d2qmwa1 appears in SCOPe 2.01
  
• d2qmwa1 appears in the current release, SCOPe 2.08