Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Prephenate dehydratase [159808] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [159809] (2 PDB entries) Uniprot Q99SX2 1-184 |
Domain d2qmwa1: 2qmw A:1-184 [150899] Other proteins in same PDB: d2qmwa2, d2qmwb2 complexed with act, edo, na, peg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2qmw (more details), 2.3 Å
SCOPe Domain Sequences for d2qmwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]} mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd qnat
Timeline for d2qmwa1: