Lineage for d2qmub1 (2qmu B:176-264)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911631Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 1911632Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 1911633Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 1911636Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
    Uniprot Q97Z79 176-264
  8. 1911643Domain d2qmub1: 2qmu B:176-264 [150897]
    Other proteins in same PDB: d2qmua1, d2qmua2, d2qmua3
    automatically matched to d2ahob3
    complexed with gdp, po4, zn

Details for d2qmub1

PDB Entry: 2qmu (more details), 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2qmub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmub1 d.58.51.1 (B:176-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvv

SCOPe Domain Coordinates for d2qmub1:

Click to download the PDB-style file with coordinates for d2qmub1.
(The format of our PDB-style files is described here.)

Timeline for d2qmub1: