SCOPe 2.08: Domain d2qmub1: 2qmu B:175-264

Lineage for d2qmub1 (2qmu B:175-264)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family)

5. Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)

6. Protein eIF-2-alpha, C-terminal domain [110995] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
   Uniprot Q97Z79 176-264

8. Domain d2qmub1: 2qmu B:175-264 [150897]
   Other proteins in same PDB: d2qmua1, d2qmua2, d2qmua3, d2qmub2
   automatically matched to d2ahob3
   complexed with gdp, po4, zn

Details for d2qmub1

PDB Entry: 2qmu, 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2qmub1:

Sequence; same for both SEQRES and ATOM records:

>d2qmub1 d.58.51.1 (B:175-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
rkvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgt
npkeasealnqiisnlikigkeenvdisvv

Timeline for d2qmub1:

• d2qmub1 first appeared in SCOP 1.75
  
• d2qmub1 appears in SCOPe 2.07