Lineage for d2qmua3 (2qmu A:2-206)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830286Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))
  7. 830295Species Sulfolobus solfataricus [TaxId:2287] [142227] (5 PDB entries)
    Uniprot Q980A5 2-206
  8. 830301Domain d2qmua3: 2qmu A:2-206 [150896]
    Other proteins in same PDB: d2qmua1, d2qmua2, d2qmub1
    automatically matched to d2ahoa3
    complexed with gdp, po4, zn

Details for d2qmua3

PDB Entry: 2qmu (more details), 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOP Domain Sequences for d2qmua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmua3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOP Domain Coordinates for d2qmua3:

Click to download the PDB-style file with coordinates for d2qmua3.
(The format of our PDB-style files is described here.)

Timeline for d2qmua3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qmub1