Lineage for d2qmua2 (2qmu A:321-415)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792477Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1792550Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 1792559Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 1792576Domain d2qmua2: 2qmu A:321-415 [150895]
    Other proteins in same PDB: d2qmua1, d2qmua3, d2qmub1
    automatically matched to d2ahoa2
    complexed with gdp, po4, zn

Details for d2qmua2

PDB Entry: 2qmu (more details), 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2qmua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmua2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d2qmua2:

Click to download the PDB-style file with coordinates for d2qmua2.
(The format of our PDB-style files is described here.)

Timeline for d2qmua2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qmub1