SCOP 1.75: Domain d2qmua2: 2qmu A:321-415

Lineage for d2qmua2 (2qmu A:321-415)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141344] (5 PDB entries)
   Uniprot Q980A5 321-415

8. Domain d2qmua2: 2qmu A:321-415 [150895]
   Other proteins in same PDB: d2qmua1, d2qmua3, d2qmub1
   automatically matched to d2ahoa2
   complexed with gdp, po4, zn

Details for d2qmua2

PDB Entry: 2qmu, 3.2 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOP Domain Sequences for d2qmua2:

Sequence; same for both SEQRES and ATOM records:

>d2qmua2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Timeline for d2qmua2:

• d2qmua2 is new in SCOP 1.75
  
• d2qmua2 appears in SCOPe 2.01
  
• d2qmua2 appears in the current release, SCOPe 2.08