Lineage for d2qmsb_ (2qms B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965460Protein Growth factor receptor-bound protein 7 [103135] (1 species)
  7. 2965461Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries)
  8. 2965463Domain d2qmsb_: 2qms B: [150891]
    automated match to d1mw4a_
    complexed with so4

Details for d2qmsb_

PDB Entry: 2qms (more details), 2.1 Å

PDB Description: Crystal structure of a signaling molecule
PDB Compounds: (B:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d2qmsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmsb_ d.93.1.1 (B:) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
slsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlqkvkh
ylilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

SCOPe Domain Coordinates for d2qmsb_:

Click to download the PDB-style file with coordinates for d2qmsb_.
(The format of our PDB-style files is described here.)

Timeline for d2qmsb_: