| Class b: All beta proteins [48724] (174 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
| Domain d2qmpa_: 2qmp A: [150888] automated match to d1a8ga_ protein/DNA complex; protein/RNA complex; complexed with a00 |
PDB Entry: 2qmp (more details), 1.8 Å
SCOPe Domain Sequences for d2qmpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d2qmpa_: