![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.7: AF1056-like [159518] (2 proteins) Pfam PF04013; DUF358 |
![]() | Protein Uncharacterized protein AF1056 [159519] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [159520] (1 PDB entry) Uniprot O29206 95-288 |
![]() | Domain d2qmmb2: 2qmm B:95-288 [150887] Other proteins in same PDB: d2qmma2, d2qmmb3 automated match to d2qmma1 complexed with sam |
PDB Entry: 2qmm (more details), 1.85 Å
SCOPe Domain Sequences for d2qmmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmmb2 c.116.1.7 (B:95-288) Uncharacterized protein AF1056 {Archaeoglobus fulgidus [TaxId: 2234]} vrgflivgnkaftqpfslndlpgagrmdvlcrctsqalfishgirrdvevyllllgppsp pksilikgdevrrmspdernvaghikkalavecgkswkkvhsgvyvsrkgleelieelse kysiiylkedgvdisnaqlppnplfvigdheglteeqekvveryaalklslsplsllaeq cvviahhhldrlqf
Timeline for d2qmmb2: