Lineage for d2qmmb2 (2qmm B:95-288)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921406Family c.116.1.7: AF1056-like [159518] (2 proteins)
    Pfam PF04013; DUF358
  6. 2921407Protein Uncharacterized protein AF1056 [159519] (1 species)
  7. 2921408Species Archaeoglobus fulgidus [TaxId:2234] [159520] (1 PDB entry)
    Uniprot O29206 95-288
  8. 2921410Domain d2qmmb2: 2qmm B:95-288 [150887]
    Other proteins in same PDB: d2qmma2, d2qmmb3
    automated match to d2qmma1
    complexed with sam

Details for d2qmmb2

PDB Entry: 2qmm (more details), 1.85 Å

PDB Description: Crystal structure of APC86534.1 (C-terminal domain of NCBI AAB90184.1; Pfam BIG 123.1)
PDB Compounds: (B:) UPF0217 protein AF_1056

SCOPe Domain Sequences for d2qmmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmmb2 c.116.1.7 (B:95-288) Uncharacterized protein AF1056 {Archaeoglobus fulgidus [TaxId: 2234]}
vrgflivgnkaftqpfslndlpgagrmdvlcrctsqalfishgirrdvevyllllgppsp
pksilikgdevrrmspdernvaghikkalavecgkswkkvhsgvyvsrkgleelieelse
kysiiylkedgvdisnaqlppnplfvigdheglteeqekvveryaalklslsplsllaeq
cvviahhhldrlqf

SCOPe Domain Coordinates for d2qmmb2:

Click to download the PDB-style file with coordinates for d2qmmb2.
(The format of our PDB-style files is described here.)

Timeline for d2qmmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qmmb3