SCOP 1.75: Domain d2qmka1: 2qmk A:404-496

Lineage for d2qmka1 (2qmk A:404-496)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (42 PDB entries)
   Uniprot P04746 16-511
   SQ 04746
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d2qmka1: 2qmk A:404-496 [150884]
   Other proteins in same PDB: d2qmka2
   automatically matched to d1c8qa1
   complexed with ca, nag, no2

Details for d2qmka1

PDB Entry: 2qmk, 2.3 Å

PDB Description: human pancreatic alpha-amylase complexed with nitrite

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOP Domain Sequences for d2qmka1:

Sequence; same for both SEQRES and ATOM records:

>d2qmka1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d2qmka1:

• d2qmka1 is new in SCOP 1.75
  
• d2qmka1 appears in SCOPe 2.01
  
• d2qmka1 appears in the current release, SCOPe 2.08