SCOPe 2.06: Domain d2qm9b_: 2qm9 B:

Lineage for d2qm9b_ (2qm9 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d2qm9b_: 2qm9 B: [150877]
   Other proteins in same PDB: d2qm9a3
   automated match to d3p6da_
   complexed with so4, tdz

Details for d2qm9b_

PDB Entry: 2qm9, 2.31 Å

PDB Description: troglitazone bound to fatty acid binding protein 4

PDB Compounds: (B:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d2qm9b_:

Sequence; same for both SEQRES and ATOM records:

>d2qm9b_ b.60.1.2 (B:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfkn
teisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvm
kgvtstrvyera

Timeline for d2qm9b_:

• d2qm9b_ first appeared in SCOP 1.75, called d2qm9b1
  
• d2qm9b_ appears in SCOPe 2.05
  
• d2qm9b_ appears in SCOPe 2.07
  
• d2qm9b_ appears in the current release, SCOPe 2.08