Lineage for d2qm9b_ (2qm9 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2395949Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2395976Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)
  8. 2395998Domain d2qm9b_: 2qm9 B: [150877]
    Other proteins in same PDB: d2qm9a3
    automated match to d3p6da_
    complexed with so4, tdz

Details for d2qm9b_

PDB Entry: 2qm9 (more details), 2.31 Å

PDB Description: troglitazone bound to fatty acid binding protein 4
PDB Compounds: (B:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d2qm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qm9b_ b.60.1.2 (B:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfkn
teisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d2qm9b_:

Click to download the PDB-style file with coordinates for d2qm9b_.
(The format of our PDB-style files is described here.)

Timeline for d2qm9b_: