Lineage for d2qm7a1 (2qm7 A:5-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111984Protein Metallochaperone MeaB [159564] (1 species)
    ArgK-like (sub)family; Pfam PF03308
  7. 2111985Species Methylobacterium extorquens [TaxId:408] [159565] (5 PDB entries)
    Uniprot Q8RPA0 5-327
  8. 2111988Domain d2qm7a1: 2qm7 A:5-327 [150872]
    complexed with gdp, po4

Details for d2qm7a1

PDB Entry: 2qm7 (more details), 1.85 Å

PDB Description: MeaB, A Bacterial Homolog of MMAA, Bound to GDP
PDB Compounds: (A:) GTPase/ATPase

SCOPe Domain Sequences for d2qm7a1:

Sequence, based on SEQRES records: (download)

>d2qm7a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}
lpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgvp
gvgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafirpsp
ssgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpgagdel
qgikkgifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisglh
gkgldslwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqatae
aeravaggehspaagadaiatli

Sequence, based on observed residues (ATOM records): (download)

>d2qm7a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}
lpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgvp
gvgksttidalgslltaaghkvavlavdpsstrtrmarlaidrnafirpspssgtlggva
aktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpgagdelqgikkgife
ladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisglhgkgldslws
riedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqataeaeravagge
hspaagadaiatli

SCOPe Domain Coordinates for d2qm7a1:

Click to download the PDB-style file with coordinates for d2qm7a1.
(The format of our PDB-style files is described here.)

Timeline for d2qm7a1: