Lineage for d2qlve2 (2qlv E:307-412)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617233Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 2617234Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 2617235Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 2617245Protein SIP2 [160221] (1 species)
  7. 2617246Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160222] (1 PDB entry)
    Uniprot P34164 306-412
  8. 2617248Domain d2qlve2: 2qlv E:307-412 [150871]
    Other proteins in same PDB: d2qlva1, d2qlvb1, d2qlvc1, d2qlvc2, d2qlvd_, d2qlve1, d2qlvf1, d2qlvf2
    automated match to d2qlvb2

Details for d2qlve2

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (E:) Protein SIP2

SCOPe Domain Sequences for d2qlve2:

Sequence, based on SEQRES records: (download)

>d2qlve2 d.353.1.1 (E:307-412) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdipavftdpsvmeryyytldrqqsntdtswltppqlppqlenvilnkyyatqdqfnenn
sgalpipnhvvlnhlvtssikhntlcvasivrykqkyvtqilytpi

Sequence, based on observed residues (ATOM records): (download)

>d2qlve2 d.353.1.1 (E:307-412) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdipavftppqlppqhvvlnhlvtssikhntlcvasivrykqkyvtqilytpi

SCOPe Domain Coordinates for d2qlve2:

Click to download the PDB-style file with coordinates for d2qlve2.
(The format of our PDB-style files is described here.)

Timeline for d2qlve2: