SCOPe 2.06: Domain d2qlve1: 2qlv E:161-247

Lineage for d2qlve1 (2qlv E:161-247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein SIP2 [158889] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158890] (1 PDB entry)
   Uniprot P34164 161-247

8. Domain d2qlve1: 2qlv E:161-247 [150870]
   Other proteins in same PDB: d2qlva1, d2qlvb2, d2qlvc1, d2qlvc2, d2qlvd_, d2qlve2, d2qlvf1, d2qlvf2
   automated match to d2qlvb1

Details for d2qlve1

PDB Entry: 2qlv, 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1

PDB Compounds: (E:) Protein SIP2

SCOPe Domain Sequences for d2qlve1:

Sequence; same for both SEQRES and ATOM records:

>d2qlve1 b.1.18.21 (E:161-247) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
nelrvsdflptatdqmgnfvnyievrq

Timeline for d2qlve1:

• d2qlve1 first appeared in SCOP 1.75
  
• d2qlve1 appears in SCOPe 2.05
  
• d2qlve1 appears in SCOPe 2.07
  
• d2qlve1 appears in the current release, SCOPe 2.08