Lineage for d2qlvb2 (2qlv B:306-412)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053872Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 1053873Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
  5. 1053874Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 1053886Protein SIP2 [160221] (1 species)
  7. 1053887Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160222] (1 PDB entry)
    Uniprot P34164 306-412
  8. 1053888Domain d2qlvb2: 2qlv B:306-412 [150868]
    Other proteins in same PDB: d2qlva1, d2qlvb1, d2qlvd_, d2qlve1

Details for d2qlvb2

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (B:) Protein SIP2

SCOPe Domain Sequences for d2qlvb2:

Sequence, based on SEQRES records: (download)

>d2qlvb2 d.353.1.1 (B:306-412) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttdipavftdpsvmeryyytldrqqsntdtswltppqlppqlenvilnkyyatqdqfnen
nsgalpipnhvvlnhlvtssikhntlcvasivrykqkyvtqilytpi

Sequence, based on observed residues (ATOM records): (download)

>d2qlvb2 d.353.1.1 (B:306-412) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttdipavftdpsvmeryyytldrppqlppqhvvlnhlvtssikhntlcvasivrykqkyv
tqilytpi

SCOPe Domain Coordinates for d2qlvb2:

Click to download the PDB-style file with coordinates for d2qlvb2.
(The format of our PDB-style files is described here.)

Timeline for d2qlvb2: