Lineage for d2qlvb1 (2qlv B:161-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765993Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2766024Protein SIP2 [158889] (1 species)
  7. 2766025Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158890] (1 PDB entry)
    Uniprot P34164 161-247
  8. 2766026Domain d2qlvb1: 2qlv B:161-247 [150867]
    Other proteins in same PDB: d2qlva1, d2qlvb2, d2qlvc1, d2qlvc2, d2qlvd_, d2qlve2, d2qlvf1, d2qlvf2

Details for d2qlvb1

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (B:) Protein SIP2

SCOPe Domain Sequences for d2qlvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
nelrvsdflptatdqmgnfvnyievrq

SCOPe Domain Coordinates for d2qlvb1:

Click to download the PDB-style file with coordinates for d2qlvb1.
(The format of our PDB-style files is described here.)

Timeline for d2qlvb1: