Lineage for d2qlva1 (2qlv A:460-630)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582738Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2582747Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 2582751Protein Carbon catabolite-derepressing protein kinase SNF1 [160724] (1 species)
  7. 2582752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160725] (1 PDB entry)
    Uniprot P06782 460-630
  8. 2582753Domain d2qlva1: 2qlv A:460-630 [150866]
    Other proteins in same PDB: d2qlvb1, d2qlvb2, d2qlvc1, d2qlvc2, d2qlve1, d2qlve2, d2qlvf1, d2qlvf2

Details for d2qlva1

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (A:) Carbon catabolite derepressing protein kinase

SCOPe Domain Sequences for d2qlva1:

Sequence, based on SEQRES records: (download)

>d2qlva1 d.129.6.2 (A:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvm
geiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnn
ylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavns

Sequence, based on observed residues (ATOM records): (download)

>d2qlva1 d.129.6.2 (A:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ykeedstvsilptslpqihranmlaqgspaaskisplvttrwhfgirsrsypldvmgeiy
ialknlgaewakpslwtiklrwkdlmkmviqlfqnnylvdfkfdgwesemstfsaypflh
lttklimelavns

SCOPe Domain Coordinates for d2qlva1:

Click to download the PDB-style file with coordinates for d2qlva1.
(The format of our PDB-style files is described here.)

Timeline for d2qlva1: