Lineage for d2qlsd1 (2qls D:1-146)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759034Species Canis lupus familiaris [TaxId:9615] [158218] (1 PDB entry)
  8. 759036Domain d2qlsd1: 2qls D:1-146 [150865]
    automatically matched to d1fhjb_
    complexed with hem

Details for d2qlsd1

PDB Entry: 2qls (more details), 3.5 Å

PDB Description: crystal structure of hemoglobin from dog (canis familiaris) at 3.5 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOP Domain Sequences for d2qlsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlsd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Canis lupus familiaris [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d2qlsd1:

Click to download the PDB-style file with coordinates for d2qlsd1.
(The format of our PDB-style files is described here.)

Timeline for d2qlsd1: