Lineage for d2ql1a1 (2ql1 A:236-339)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934151Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 934152Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 934166Domain d2ql1a1: 2ql1 A:236-339 [150859]
    Other proteins in same PDB: d2ql1a2
    automatically matched to d1hzhh3
    complexed with zn

Details for d2ql1a1

PDB Entry: 2ql1 (more details), 2.53 Å

PDB Description: structural characterization of a mutated, adcc-enhanced human fc fragment
PDB Compounds: (A:) IGHM protein

SCOPe Domain Sequences for d2ql1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ql1a1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiska

SCOPe Domain Coordinates for d2ql1a1:

Click to download the PDB-style file with coordinates for d2ql1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ql1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ql1a2