Lineage for d2ql1a1 (2ql1 A:236-339)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
Domain d2ql1a1: 2ql1 A:236-339 [150859]
Other proteins in same PDB: d2ql1a2
automated match to d1hzhh3
complexed with zn
Details for d2ql1a1
PDB Entry: 2ql1 (more details), 2.53 Å
PDB Description: structural characterization of a mutated, adcc-enhanced human fc fragment
PDB Compounds: (A:) IGHM proteinSCOPe Domain Sequences for d2ql1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ql1a1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiska
SCOPe Domain Coordinates for d2ql1a1:
Click to download the PDB-style file with coordinates for d2ql1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ql1a1:
- d2ql1a1 first appeared in SCOP 1.75
- d2ql1a1 appears in SCOPe 2.07
View in 3D
