Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) |
Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
Protein Rubredoxin [57804] (8 species) |
Species Desulfovibrio vulgaris [TaxId:881] [57805] (7 PDB entries) |
Domain d2ql0a1: 2ql0 A:1-52 [150858] automatically matched to d1rb9a_ complexed with zn |
PDB Entry: 2ql0 (more details)
SCOPe Domain Sequences for d2ql0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ql0a1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]} mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa
Timeline for d2ql0a1: