Lineage for d2ql0a1 (2ql0 A:1-52)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893110Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 893119Protein Rubredoxin [57804] (6 species)
  7. 893169Species Desulfovibrio vulgaris [TaxId:881] [57805] (7 PDB entries)
  8. 893177Domain d2ql0a1: 2ql0 A:1-52 [150858]
    automatically matched to d1rb9a_
    complexed with zn

Details for d2ql0a1

PDB Entry: 2ql0 (more details)

PDB Description: zinc-substituted rubredoxin from desulfovibrio vulgaris
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d2ql0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ql0a1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOP Domain Coordinates for d2ql0a1:

Click to download the PDB-style file with coordinates for d2ql0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ql0a1: