Lineage for d2qkyb1 (2qky B:39-508)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807891Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 807975Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 807976Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 807983Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 807984Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
    Uniprot P27487 39-776
    Uniprot P27487
    Uniprot P27487
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 808054Domain d2qkyb1: 2qky B:39-508 [150851]
    Other proteins in same PDB: d2qkya2, d2qkyb2, d2qkyc2, d2qkyd2
    automatically matched to d1orva1
    complexed with 13z

Details for d2qkyb1

PDB Entry: 2qky (more details), 3.1 Å

PDB Description: complex structure of dipeptidyl peptidase iv and a oxadiazolyl ketone
PDB Compounds: (B:) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP) (Dipeptidyl peptidase 4 soluble form) (Dipeptidyl peptidase IV soluble form)

SCOP Domain Sequences for d2qkyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkyb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d2qkyb1:

Click to download the PDB-style file with coordinates for d2qkyb1.
(The format of our PDB-style files is described here.)

Timeline for d2qkyb1: