Lineage for d2qkya1 (2qky A:40-508)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066692Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2066693Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2066700Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2066701Species Human (Homo sapiens) [TaxId:9606] [82174] (93 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2066894Domain d2qkya1: 2qky A:40-508 [150849]
    Other proteins in same PDB: d2qkya2, d2qkya3, d2qkyb2, d2qkyb3, d2qkyc2, d2qkyc3, d2qkyd2, d2qkyd3
    automated match to d4n8eb1
    complexed with 13z

Details for d2qkya1

PDB Entry: 2qky (more details), 3.1 Å

PDB Description: complex structure of dipeptidyl peptidase iv and a oxadiazolyl ketone
PDB Compounds: (A:) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP) (Dipeptidyl peptidase 4 soluble form) (Dipeptidyl peptidase IV soluble form)

SCOPe Domain Sequences for d2qkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkya1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2qkya1:

Click to download the PDB-style file with coordinates for d2qkya1.
(The format of our PDB-style files is described here.)

Timeline for d2qkya1: