Class a: All alpha proteins [46456] (290 folds) |
Fold a.242: Dcp2 domain-like [140585] (1 superfamily) 4 helices; orthogonal array of two alpha hairpins |
Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) automatically mapped to Pfam PF05026 |
Family a.242.1.1: Dcp2 box A domain [140587] (1 protein) Pfam PF05026 |
Protein mRNA decapping enzyme Dcp2p, N-terminal domain [140588] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [140589] (3 PDB entries) Uniprot O13828 1-94 |
Domain d2qklb_: 2qkl B: [150847] automated match to d2qklb1 protein/RNA complex; complexed with pb |
PDB Entry: 2qkl (more details), 2.33 Å
SCOPe Domain Sequences for d2qklb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qklb_ a.242.1.1 (B:) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} sftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslgl rvfsaklfahcpllwkwskvheeafddflr
Timeline for d2qklb_: