Lineage for d2qklb_ (2qkl B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738104Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
    4 helices; orthogonal array of two alpha hairpins
  4. 2738105Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) (S)
    automatically mapped to Pfam PF05026
  5. 2738106Family a.242.1.1: Dcp2 box A domain [140587] (1 protein)
    Pfam PF05026
  6. 2738107Protein mRNA decapping enzyme Dcp2p, N-terminal domain [140588] (1 species)
  7. 2738108Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [140589] (3 PDB entries)
    Uniprot O13828 1-94
  8. 2738109Domain d2qklb_: 2qkl B: [150847]
    automated match to d2qklb1
    protein/RNA complex; complexed with pb

Details for d2qklb_

PDB Entry: 2qkl (more details), 2.33 Å

PDB Description: The crystal structure of fission yeast mRNA decapping enzyme Dcp1-Dcp2 complex
PDB Compounds: (B:) SPAC19A8.12 protein

SCOPe Domain Sequences for d2qklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qklb_ a.242.1.1 (B:) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslgl
rvfsaklfahcpllwkwskvheeafddflr

SCOPe Domain Coordinates for d2qklb_:

Click to download the PDB-style file with coordinates for d2qklb_.
(The format of our PDB-style files is described here.)

Timeline for d2qklb_: