Lineage for d2qkcc2 (2qkc C:84-196)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2513722Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 protein domains)
  6. 2513848Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2513912Species Human (Homo sapiens) [TaxId:9606] [54724] (31 PDB entries)
  8. 2513972Domain d2qkcc2: 2qkc C:84-196 [150846]
    Other proteins in same PDB: d2qkca1, d2qkcc1
    automated match to d1xila2
    complexed with mn

Details for d2qkcc2

PDB Entry: 2qkc (more details), 2.3 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
PDB Compounds: (C:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2qkcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkcc2 d.44.1.1 (C:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac

SCOPe Domain Coordinates for d2qkcc2:

Click to download the PDB-style file with coordinates for d2qkcc2.
(The format of our PDB-style files is described here.)

Timeline for d2qkcc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkcc1