SCOPe 2.06: Domain d2qkac2: 2qka C:84-196

Lineage for d2qkac2 (2qka C:84-196)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein automated matches [226880] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255569] (2 PDB entries)

8. Domain d2qkac2: 2qka C:84-196 [150842]
   Other proteins in same PDB: d2qkaa1, d2qkac1
   automated match to d1xila2
   complexed with mn

Details for d2qkac2

PDB Entry: 2qka, 2.2 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases

PDB Compounds: (C:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2qkac2:

Sequence; same for both SEQRES and ATOM records:

>d2qkac2 d.44.1.1 (C:84-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac

Timeline for d2qkac2:

• d2qkac2 first appeared in SCOP 1.75
  
• d2qkac2 appears in SCOPe 2.05
  
• d2qkac2 appears in SCOPe 2.07
  
• d2qkac2 appears in the current release, SCOPe 2.08