SCOP 1.67: Domain d1jdo__: 1jdo -

Lineage for d1jdo__ (1jdo -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (148 PDB entries)

8. Domain d1jdo__: 1jdo - [15084]
   complexed with hem, no, so4; mutant

Details for d1jdo__

PDB Entry: 1jdo, 1.9 Å

PDB Description: sperm whale myoglobin (ferrous, nitric oxide bound)

SCOP Domain Sequences for d1jdo__:

Sequence; same for both SEQRES and ATOM records:

>d1jdo__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1jdo__:

• d1jdo__ first appeared (with stable ids) in SCOP 1.55
  
• d1jdo__ appears in SCOP 1.65
  
• d1jdo__ appears in SCOP 1.69
  
• d1jdo__ appears in the current release, SCOPe 2.08, called d1jdoa_