Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein automated matches [227044] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255568] (2 PDB entries) |
Domain d2qkaa1: 2qka A:1-83 [150839] Other proteins in same PDB: d2qkaa2, d2qkac2 automated match to d1pl4a1 complexed with mn |
PDB Entry: 2qka (more details), 2.2 Å
SCOPe Domain Sequences for d2qkaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkaa1 a.2.11.1 (A:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial qpalkanggghinhsifwtnlsp
Timeline for d2qkaa1: