![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
![]() | Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species) member of rp/eb family |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101195] (5 PDB entries) Uniprot Q15691 2-132 |
![]() | Domain d2qjzb_: 2qjz B: [150836] automated match to d1v5ka_ |
PDB Entry: 2qjz (more details), 1.25 Å
SCOPe Domain Sequences for d2qjzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjzb_ a.40.1.1 (B:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} lsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyiqn fkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaarqgq
Timeline for d2qjzb_: