Lineage for d2qjza_ (2qjz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1734998Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 1735036Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 1735037Species Human (Homo sapiens) [TaxId:9606] [101195] (5 PDB entries)
    Uniprot Q15691 2-132
  8. 1735038Domain d2qjza_: 2qjz A: [150835]
    automated match to d1v5ka_

Details for d2qjza_

PDB Entry: 2qjz (more details), 1.25 Å

PDB Description: structural basis of microtubule plus end tracking by xmap215, clip-170 and eb1
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2qjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjza_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]}
dnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakleheyi
qnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkdydpvaarqg
q

SCOPe Domain Coordinates for d2qjza_:

Click to download the PDB-style file with coordinates for d2qjza_.
(The format of our PDB-style files is described here.)

Timeline for d2qjza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qjzb_