SCOP 1.75: Domain d2qjrb1: 2qjr B:39-508

Lineage for d2qjrb1 (2qjr B:39-508)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
   Uniprot P27487 39-776
   Uniprot P27487
   Uniprot P27487
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2qjrb1: 2qjr B:39-508 [150832]
   Other proteins in same PDB: d2qjra2, d2qjrb2
   automatically matched to d1orva1
   complexed with lgu, man, nag, ndg, pzf

Details for d2qjrb1

PDB Entry: 2qjr, 2.2 Å

PDB Description: dipepdyl peptidase iv in complex with inhibitor pzf

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2qjrb1:

Sequence; same for both SEQRES and ATOM records:

>d2qjrb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2qjrb1:

• d2qjrb1 is new in SCOP 1.75
  
• d2qjrb1 appears in SCOPe 2.01
  
• d2qjrb1 appears in the current release, SCOPe 2.08